Vasavi Kanyaka Parameswari temples
Every temple, satram, sangam and trust recorded in Andhra Pradesh and Telangana that carries her name. This is the community's own map — where it built, endowed and fed. Each entry links to the source that documents it.
115 institutions
81 places
40 districts
12 high confidence
0 with a photograph
About the pictures. A photograph appears only where a freely licensed one
exists for that exact building, with its licence and author recorded. Most of these
temples have none, so most cards show no photograph. Filling those gaps with stock
images or generated artwork would leave you believing you had seen a temple you had
not — the image on this page is devotional artwork made for this site, and is
not any of these murtis.
Andhra Pradesh · 72
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyaka Parameswari shrine, Anakapalli
Anakapalli,
Anakapalli
The official Visakhapatnam district portal names 'the shrine of Kanyaka Parameswari' at Anakapalli, alongside Nookalamma, as famous and drawing large numbers of devotees. Kanyaka Parameswari is the Arya Vysya kuladevata.
No freely licensed photograph
of this building yet
of this building yet
Kanyaka Parameswari temple built by the Komatis of Gooty
Gooty,
Anantapur
1905 Madras District Gazetteer, Ch. XV, p. 154, verbatim: 'There are no temples of architectural merit in Gooty... The Komatis have built a new temple to their patron goddess Kanyaka Paramesvari. The mass of the people pay their c…
No freely licensed photograph
of this building yet
of this building yet
Kanyakamma (Kanyaka Parameswari) temple built by the local Komatis, in a bazaar street of Tadipatri
Tadipatri,
Anantapur
1905 Madras District Gazetteer, Ch. XV, p. 202, verbatim: 'In one of the bazaar streets is a noteworthy construction. It is a temple which is being erected by the local Komatis to their caste goddess Kanyakamma, the deified form o…
No freely licensed photograph
of this building yet
of this building yet
Vysya Bank branch, Hindupur
Hindupur,
Sri Sathya Sai
Listed in the banking table of the District Census Handbook, Anantapur District (1961 Census). Recorded because the name is an explicit Arya Vysya / Vysya community marker. No individual names recorded. Present-day status NOT veri…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Kanyaka Parameswari Temple, Vizianagaram
Vizianagaram,
Vizianagaram
The official district site states: 'This temple is situated in Vizianagaram Town and it was built in the year 1890 by the Komatis (Trading community)', on land donated by the Maharaja of Vizianagaram. Komati = Arya Vysya; Kanyaka …
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyakaparameshwari Ammavari Temple, Penugonda
Vasavi Penugonda (Penugonda),
West Godavari
Official West Godavari district government tourism page states verbatim: 'This Penugonda Kshetram is considered as the Kasi of Vysyas and is a holy place' for the community, and records Kusuma Sresti, a Setty king of the Vysyas al…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple (Sri Matha Kanyakaparameswari Devi Temple / Ammavarisala)
Proddatur,
YSR Kadapa
Established 1890 in Proddatur. Principal deity of the Arya Vysya (Vaishya) community. Administered by the local Arya Vaishya Sangam / Arya Vysya Sabha. Dasara (Sharannavaratri) festival celebrated annually since 1895.
No freely licensed photograph
of this building yet
of this building yet
Temple of Kanyakamma (Kanyaka Parameswari), Vanipenta
Vanipenta,
YSR Kadapa
The 1915 Cuddapah Gazetteer states: 'In the main street in the centre of the village is a large temple of Kanyakamma erected by the Komati community who specially worship this goddess. It is of modern construction and built of Cud…
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Seva Sangham, Mantralayam
Mantralayam,
Kurnool
Listed on the Arya Vysya community register of satrams and community bodies as operating at Mantralayam.
No freely licensed photograph
of this building yet
of this building yet
Sri Valli Subrahmanyeswara Swamy Arya Vysya Annadana Satram, Subbarayuni Kotturu
Subbarayuni Kotturu,
Kurnool
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Subbarayuni Kotturu, Kurnool district.
No freely licensed photograph
of this building yet
of this building yet
Sri Omkara Kshetra Arya Vysya Anna Satram Sangham, Bandi Atmakur
Bandi Atmakur,
Nandyal
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Bandi Atmakur.
No freely licensed photograph
of this building yet
of this building yet
Mahanandi Kshetra Arya Vysya Nityanna Satra Sangham, Diguva Ahobilam
Diguva Ahobilam (Lower Ahobilam),
Nandyal
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Diguva (lower) Ahobilam.
No freely licensed photograph
of this building yet
of this building yet
Srimath Pedda Ahobila Arya Vysya Anna Satram, Eguva Ahobilam
Eguva Ahobilam (Upper Ahobilam),
Nandyal
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Eguva (upper) Ahobilam.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Choudeswari Arya Vysya Nityannadana Satram, Nandavaram
Nandavaram,
Nandyal
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Nandavaram; named for the presiding goddess Chowdeswari.
No freely licensed photograph
of this building yet
of this building yet
Kolanu Bharathi Arya Vysya Nityanna Satram, Kolanubharathi Kshetram, Sivapuram, Kothapalli
Sivapuram / Kolanubharathi,
Nandyal
Listed on the Arya Vysya community register of nitya-annadana satrams at the Kolanubharathi kshetram, Sivapuram, Kothapalli.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Amara Sriramulu Sreshti Arya Vysya Nityannadana Satram, Penchalakona
Penchalakona,
Nellore
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Penchalakona, Nellore district. The institution is named after its founding endower; 'Sreshti' (Setti / Chetty) is the characteristic Arya Vysya h…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Nityanna Dharmasala (satram), Salur
Salur,
Parvathipuram Manyam
Arya Vysya nitya-annadana satram (free-meal pilgrim inn) listed in the Telugu Wikipedia register of Arya Vysya nityanna satrams. Corroborated by an Arya Vysya sathram directory (https://aryavysyasangam.com/sathrams, low confidence…
No freely licensed photograph
of this building yet
of this building yet
Sri Narayana Swamy Kshetra Arya Vysya Anna Satra Sangham, Kovilampadu
Kovilampadu,
Prakasam
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Kovilampadu, Prakasam district.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Nityannadana Satram, Mogilicherla
Mogilicherla,
Prakasam
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Mogilicherla, Prakasam district.
No freely licensed photograph
of this building yet
of this building yet
Sri Bala Koteswara Swamy Arya Vysya Nityannadana Satram, Nandanamarella, Kanigiri
Nandanamarella,
Prakasam
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Nandanamarella, Kanigiri, Prakasam district.
No freely licensed photograph
of this building yet
of this building yet
Sri Nemaligundla Ranganayakula Swamy Arya Vysya Nityanna Satram, Nemaligundla
Nemaligundla,
Prakasam
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Nemaligundla, Prakasam district.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Arya Vysya Nitya Annadana Samajam, Ramatheertham
Ramatheertham,
Prakasam
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Ramatheertham, Prakasam district. This is the only institution in the four districts that carries the full 'Vasavi Kanyaka Parameswari' name in it…
No freely licensed photograph
of this building yet
of this building yet
Akhila Bharata Arya Vysya Vruddha Ashramam and Nityannadana Satram, Tripurantakam
Tripurantakam,
Prakasam
Listed on the Arya Vysya community register as an all-India Arya Vysya home for the aged combined with a daily food-offering satram at Tripurantakam, Prakasam district.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Vaishya Anna Daan Satram, Arasavelli
Arasavalli,
Srikakulam
Arya Vysya nitya-anna satram (free-meal pilgrim inn) serving pilgrims to the Arasavalli Sun temple.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, Palasa
Palasa-Kasibugga,
Srikakulam
Listed in the Telugu Wikipedia register of Vasavi Kanyaka Parameswari temples with the location 'Palasa (Srikakulam district), Andhra Pradesh 532221'. The Palasa town article itself does not mention it, so on-ground confirmation i…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, One Town / Fort Ward
Visakhapatnam,
Visakhapatnam
Gopura-style temple in the old One Town trading quarter near Kurupam Market, reported as about 135 years old and revered by the Arya Vysya community as their ilavelpu (family deity); favoured by the business community of the north…
No freely licensed photograph
of this building yet
of this building yet
Vysya Students Hostel, Visakhapatnam (The Vysya Students Welfare Association, Vizagpatam)
Visakhapatnam,
Visakhapatnam
Community charitable hostel at Maharanipeta near Jagadamba Junction, established 18 October 1937 to house and fund Arya Vysya students studying in the city; accommodation is free and students run the mess cooperatively. Blocks reb…
No freely licensed photograph
of this building yet
of this building yet
Vysya Students Hostel - Madhurawada branch
Visakhapatnam,
Visakhapatnam
Second hostel block of the same 1937 association, at Midhilapuri VUDA Colony, Madhurawada, on a 600 sq yd site for about 80 Arya Vysya students attending the Madhurawada college cluster; new building inaugurated 18 June 2017.
No freely licensed photograph
of this building yet
of this building yet
Vasavi Clubs International - 'E' Vanitha Greater Visakha club (No. 4282)
Visakhapatnam,
Visakhapatnam
Vasavi Clubs International, the Arya Vysya service-club movement founded at Hyderabad in 1961, lists a Greater Visakha Vanitha club among its chartered clubs.
No freely licensed photograph
of this building yet
of this building yet
Vasavi Clubs International - first Vanitha (women's) club
Vizianagaram,
Vizianagaram
Vasavi Clubs International, the Arya Vysya service-club movement founded at Hyderabad in 1961, states on its own site that its first Vanitha (women's) club was started at Vizianagaram in 2001-02.
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Nityannadana Samajam, Penugonda
Vasavi Penugonda (Penugonda),
West Godavari
Community charitable organisation at Penugonda providing nithya annadanam (daily free meals) and pilgrim welfare services; the organisation's own site states it has served since 1972.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
The Proddatur Arya Vysya Yuvajana Samakhya (TPAVYS)
Proddatur,
YSR Kadapa
Arya Vysya community youth association based in Proddatur, registered in 2023 (registration no. 209/2023) per its own site; runs medical camps, educational support and community awareness programmes. Recorded as an institution onl…
No freely licensed photograph
of this building yet
of this building yet
Akhila Bharatha Kanipakam Kshetra Arya Vysya Nithya Anna Poorna Sathram, Kanipakam
Kanipakam,
Chittoor
Arya Vysya free-dining choultry at the Kanipakam temple site, per community satram listings. Uncited listing only; institution name and town recorded, no contact details.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devi Devasthanam, R Agraharam, Guntur
Guntur,
Guntur
Arya Vysya devasthanam on Etukuru Road, R Agraharam. Secondary accounts describe it as over 100 years old with a temple board running annadanam and community welfare, but the temple's own domain (srikanyakaparameshwaritemple.com) …
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Kalyana Mandapam, Pedanandipadu
Pedanandipadu,
Guntur
Community marriage hall carrying the Arya Vysya name. Listed only in a commercial business directory; no official or endowments-department confirmation was found.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyakaparameswari Vysya Vidhyanidhi, Ithanagar, Tenali
Tenali,
Guntur
Arya Vysya educational endowment - 'vidyanidhi' means education fund. Directory listing only; no registration document located. This is the only education-specific Vysya endowment confirmed anywhere in the belt.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Vari Temple, Suryanarayanapuram, Kakinada
Kakinada,
Kakinada
UNVERIFIED LEAD - DO NOT PUBLISH WITHOUT RE-VERIFICATION. Appears only in a commercial business directory listing, not in any official, census or scholarly source. Recorded as a research lead that a second Vasavi Kanyaka Parameswa…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyaka Parameswari Temple, Kothapet, Vijayawada
Vijayawada,
NTR
Vasavi Kanyaka Parameswari temple in the Kothapet locality, inside Vijayawada's One Town commercial quarter. Evidenced only by a commercial business directory listing. Checked against the Krishna district official endowments page …
No freely licensed photograph
of this building yet
of this building yet
Kanyaka Parameswari Temple, KT Road (Fraserpeta), Vijayawada
Vijayawada,
NTR
Second Kanyaka Parameswari temple in Vijayawada, on KT Road in the Fraserpeta area. Directory listing only.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, Stonehousepet, Nellore
Nellore,
Nellore
A Sri Vasavi Kanyaka Parameswari temple is listed at Stonehousepet, Nellore. Vasavi Kanyaka Parameswari is the kuladevata of the Arya Vysya / Komati community, so such a temple normally marks an established Arya Vysya settlement i…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, Narasaraopet Bazar
Narasaraopet,
Palnadu
Sited inside the town's bazar - the characteristic placement of an Arya Vysya temple at the centre of the merchant quarter. Directory listing only.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameshwari Temple, Penukonda
Penukonda,
Sri Sathya Sai
A Vasavi Kanyaka Parameswari temple on the main road at Penukonda appears in commercial directory and community listings. No government, endowments-department or census source confirming it was located; recorded at low confidence.
No freely licensed photograph
of this building yet
of this building yet
Vasavi Nivasam (Arya Vysya nitya anna satram)
Puttaparthi,
Sri Sathya Sai
Listed in Telugu Wikipedia's register of Arya Vysya perpetual-feeding satrams. TWO CAVEATS: the article carries a 'sources need review' banner, and the PIN printed against Puttaparthi (616134) is wrong - it is 515134. Plausible bu…
No freely licensed photograph
of this building yet
of this building yet
Srikalahasthi Vasavi Nithya Anna Santharpana Samstha
Srikalahasti,
Tirupati
Arya Vysya free-dining (nithya annadanam) institution at Srikalahasti, named in community satram listings. Uncited listing; recorded as an institution name only, no contact details.
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Satram, Tirumala - Dakshina India Arya Vysya Sri Vasavi Kanyaka Parameswari Dharma Paripalana Samstha
Tirumala,
Tirupati
Community choultry for Arya Vysya pilgrims near the Tirumala temple, per travel-booking listings. Uncited commercial listing; no official confirmation found.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, Jammalamadugu
Jammalamadugu,
YSR Kadapa
Constructed 1903 with the cooperation of the Vysya community of Jammalamadugu and surrounding area; maintained by the Komati (Arya Vysya) community through elected representatives; large Dasara gathering.
Telangana · 43
No freely licensed photograph
of this building yet
of this building yet
The Vasavi Co-operative Urban Bank Ltd., Hyderabad
Hyderabad,
Hyderabad
Co-operative urban bank licensed by the Reserve Bank of India on 13 July 1982. RBI cancelled its licence with effect from close of business 14 July 2014 after the bank ceased to be solvent; it had been classified 'weak' since July…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devasthanam, Badepally
Badepally,
Mahabubnagar
Telugu Wikipedia gives the temple its own section in the Badepally article and links it from the Jadcherla article as the first entry in Jadcherla's temple list. The section recounts the Vasavi Purana narrative (Kubera's penance f…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devalayam, Vasavi Nagar, Devarakonda Road, Kalwakurthy
Kalwakurthy,
Nagarkurnool
Has its own Telugu Wikipedia article. Foundation stone laid 1986; the idol was consecrated in 1988 on Vasavi Kanyaka Parameswari Jayanti; the temple has since held its rajatotsavam (silver jubilee) and the article describes it as …
No freely licensed photograph
of this building yet
of this building yet
Sri Bhadrachala Kshetra Vasavi Kanyaka Parameswari Arya Vysya Nityannadana Trust
Bhadrachalam,
Bhadradri Kothagudem
Arya Vysya perpetual free-meal (nitya annadana) trust serving pilgrims at the Bhadrachalam kshetram, on Market Road. Listed in three independent community registers: the Telugu register at vaasavi.net ('sri bhadrachala kshetra vas…
No freely licensed photograph
of this building yet
of this building yet
Sri Veerabhadra Swamy Arya Vysya Nitya Annadana Satram, Kothakonda
Kothakonda,
Hanamkonda
Arya Vysya perpetual free-meal satram at the Kothakonda Veerabhadra Swamy kshetram. Telugu register: 'sri veerabhadraswami aryavysya nityannasatram, Kothakonda, Karimnagar district'; English district-wise list entry 34 under 'H) K…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Public School
Himayatnagar,
Hyderabad
School at Himayatnagar, Hyderabad, sponsored by the Vasavi Academy of Education (established 1981). No community affiliation is stated by the sponsoring body.
No freely licensed photograph
of this building yet
of this building yet
Vasavi College of Music & Dance
Himayatnagar,
Hyderabad
College of music and dance at Himayatnagar, Hyderabad, sponsored by the Vasavi Academy of Education.
No freely licensed photograph
of this building yet
of this building yet
Vasavi Clubs International
Hyderabad,
Hyderabad
Largest service organisation of the Arya Vysya community. The first Vasavi Club was started on 1 October 1961 at Hyderabad with eleven members; the body became the All India Association of Vasavi Clubs (1993), the International As…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Academy of Education
Ibrahimbagh,
Hyderabad
Educational trust established 1981, office at Vasavi College of Engineering, Ibrahimbagh, Hyderabad; sponsors six institutions across Telangana and Andhra Pradesh. IMPORTANT: neither the Academy's own site nor the Wikipedia articl…
No freely licensed photograph
of this building yet
of this building yet
Vasavi College of Engineering
Ibrahimbagh,
Hyderabad
Engineering college founded in 1981 by the Vasavi Academy of Education at Ibrahimbagh, Hyderabad; affiliated to Osmania University; granted autonomy by the UGC and Osmania University, extended for ten years from 2021-22 to 2030-31…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Seva Kendram
Khairatabad,
Hyderabad
Arya Vysya community service organisation founded in 1971 with 24 founding members, established to 'promote the welfare of the Arya Vysya Community in particular and the society in general'. Published office address: 6, Telephone …
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kalyana Mandapam, Khairatabad
Khairatabad,
Hyderabad
Community wedding hall run by Vasavi Seva Kendram at its Khairatabad premises, alongside a guest house and shopping complex.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyaka Parmeshwari Devasthana Sangam, Hyderbasti
Secunderabad,
Hyderabad
Kanyaka Parameswari temple and sangam at Hyderbasti, Secunderabad. The Telangana High Court held that the institution is governed by the provisions of the Endowments Act and must strictly adhere to the statutory rules and procedur…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Arya Vysya Nityanna Satra Sangam, Palakurthi
Palakurthi,
Jangaon
Arya Vysya perpetual free-meal society; entry 81 under 'U) WARANGAL DISTRICT' in the district-wise English list, and 'vasavi aryavysya nityannasatra sangam, Palakurthi, Warangal district' in the Telugu register. Palakurthi mandal …
No freely licensed photograph
of this building yet
of this building yet
Sri Mallikarjuna Swamy Kshetra Arya Vysya Sangam, Palakurthi
Palakurthi,
Jangaon
A second Arya Vysya body at Palakurthi attached to the Mallikarjuna Swamy kshetram; entry 82 in the district-wise English list, and given on the aryavysyapdrl list as 'Palakurti - Sri mallikarjuna swami khetra aryavysya vasavi nit…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Arya Vysya Nityanna Satram, Mahadevpur mandal, Kaleshwaram
Kaleshwaram,
Jayashankar Bhupalpally
Arya Vysya perpetual free-meal satram at Kaleshwaram. Telugu register: 'sri vasavi aryavysya nityanna satram, Mahadevpur mandalam, Kaleshwaram'; English district-wise list entry 33 under 'H) KARIMNAGAR DISTRICT'; also on the aryav…
No freely licensed photograph
of this building yet
of this building yet
Sri Kaleshwara Mukteswara Sri Vasavi Annapurna Arya Vysya Nityanna Satram, Kaleshwaram
Kaleshwaram,
Jayashankar Bhupalpally
A second Arya Vysya satram at the same kshetram, named for the presiding deities; entry 32 in the district-wise English list and present in the Telugu register.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Arya Vysya Nityanna Satram (Medi Sankaraiah), Kaleshwaram
Kaleshwaram,
Jayashankar Bhupalpally
A third Arya Vysya satram at Kaleshwaram, identified in both registers by the endowing family name Medi Sankaraiah (Telugu: Medisankarayya); entry 31 in the district-wise English list.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Nityanna Satram, Alampur
Alampur,
Jogulamba Gadwal
Listed in the Telugu-language national register of Arya Vysya nitya anna satrams on the Vaasavi community portal as 'Sri Vasavi Nityanna Satram, Alampur, Mahabubnagar district' - the district label predates the 2016 reorganisation…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Arya Vysya Nityannadana Satram and Kalyana Mandapam, Beechupally
Beechupally,
Jogulamba Gadwal
Listed in the Vaasavi register as 'Sri Vasavi Arya Vysya Nityannadana Satramu, Kalyanamandapamu, Beechupally, Mahabubnagar district' - a pre-2016 district label; Beechupally is in Itikyala mandal of Jogulamba Gadwal district. It s…
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Sri Kanyaka Parameswari Nityanna Satra Sangam, Kuravi
Kuravi,
Mahabubabad
Arya Vysya perpetual free-meal society at the Kuravi kshetram. Telugu register: 'aryavysya sri kanyaka parameswari nityannasatra sangam, Kurvi, Warangal district'; English district-wise list entry 80 under 'U) WARANGAL DISTRICT' a…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameshwari Charitable Trust (Vasavi Temple, Uppal)
Uppal,
Medchal-Malkajgiri
Vasavi Kanyaka Parameshwari temple and charitable trust established by the Uppal Vysya Sangam on land donated by a community family. Published location: Street No. 2, New South Swaroop Colony, near K.K.R Gardens, Venkateshwara Swa…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devalayam, Peddakarpamula
Peddakarpamula,
Nagarkurnool
Listed in the temple register inside the Telugu Wikipedia article on Kanyaka Parameswari as 'Sri Vasavi Kanyaka Parameswari Devalayam - Peddakarpamula, Peddakothapally mandal, Nagarkurnool district, Telangana - 509412'. An address…
No freely licensed photograph
of this building yet
of this building yet
Sri Sri Vasavi Kanyakaparameswari Arya Vysya Nityannadanam Trust, Cheruvugattu
Cheruvugattu,
Nalgonda
Arya Vysya perpetual free-meal trust. Telugu register: 'sri sri vasavi kanyakaparameswari aryavysya nityannadanam trustu, Cheruvugattu, Market Palli mandalam, Nalgonda district'; the aryavysyasangam.com directory repeats it as 'Ch…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kanyaka Parameswari temple, Makhtal
Makthal,
Narayanpet
Listed among the temples of Makhtal in the Telugu Wikipedia section headed 'town of temples', alongside the Shivalayam, Kumbheswaralayam, Venkateswara, Markandeya, Ayyappa, Sathya Sai, Shirdi Sai, Veerabhadreswara and Gopalaswamy …
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyaka Parameswari Arya Vysya Nityanna Satram, Nacharam Gutta (Nachagiri)
Nacharam,
Siddipet
The Vaasavi register lists 'Sri Kanyaka Parameswari Arya Vysya Nityanna Satram, Nacharam Gutta, Medak district'. The gutta (hill) is Nachagiri, site of the Nachagiri Lakshmi Narasimha Swamy temple, which Telugu Wikipedia places at…
No freely licensed photograph
of this building yet
of this building yet
Sri Mattapalli Lakshmi Narasimha Kshetra Arya Vysya Nitya Annadana Satram
Mattapalli,
Suryapet
Arya Vysya perpetual free-meal satram at the Mattapalli kshetram. Telugu register: 'sri mattapalli lakshminarasimha kshetra aryavysya nitya annadana satram, Mattapalli'; English district-wise list entry 60 under 'N) NALGONDA DISTR…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kanyaka Parameswari temple, Pebbair
Pebbair,
Wanaparthy
Listed among Pebbair's temples on both English and Telugu Wikipedia, with the Shirdi Sai Baba, Hanuman, Brahmamgari, Venugopala Swamy, Ayyappa, Mallishwari Devi, Chowdeshwari Amma and Kodanda Rama temples. A list mention only; no …
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Arya Vysya Nityanna Satra Sangam, Yadagirigutta
Yadagirigutta,
Yadadri Bhuvanagiri
Arya Vysya perpetual free-meal society at the Yadagirigutta kshetram. Corroborated by three independent community registers: the Telugu register at vaasavi.net ('sri vasavi kanyaka parameswari aryavysya nityanna satra sangam, Yada…
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Sangam (aryavysyasangam.com)
Hyderabad,
Hyderabad
Online Arya Vysya community platform for seva, charity, cultural programmes and listings of local sangams and sathrams; the site gives a Hyderabad contact address at Chintal Basthi, Khairatabad. NOTE: the platform also hosts indiv…
No freely licensed photograph
of this building yet
of this building yet
Sri Lakshmi Narasimha Swamy Kshetra Arya Vysya Vasavi Nitya Anna Satram (also listed as 'Dharmapuri Sri Kanyakaparameshwari Aryavysya Nitya Annadana Satra Sangam')
Dharmapuri,
Jagtial
Arya Vysya nitya-annadana satram (free-feeding pilgrim choultry) attached to the Lakshmi Narasimha Swamy kshetram at Dharmapuri. Listed in three independent Arya Vysya community directories, all of which still place it in the pre-…
No freely licensed photograph
of this building yet
of this building yet
Sri Lakshmi Narasimha Swamy Kshetra Dharmapuri Arya Vaishya Vasavi Nithyanna Satram
Dharmapuri,
Jagtial
Same institution, listed in the Arya Vysya Sangam national sathram directory (machine-translated page).
No freely licensed photograph
of this building yet
of this building yet
Sri Bhakta Anjaneya Swamy Kshetram Arya Vysya Vasavi Nitya Annadana Satram Trust, Muthyampet
Muthyampet (Kondagattu),
Jagtial
Arya Vysya trust running a nitya-annadana satram at the Kondagattu Anjaneya Swamy kshetram. Listed under 'Karimnagar district' in three community directories - the pre-2016 district; Kondagattu is in Jagtial district today.
No freely licensed photograph
of this building yet
of this building yet
Sri Kalabhairava Swamy Arya Vysya Seva Sangam (nitya-anna satram)
Ramareddy,
Kamareddy
Arya Vysya seva sangam running a daily-feeding satram at the Kalabhairava Swamy shrine. Listed in the community directories under 'Nizamabad district' - the pre-2016 district; Ramareddy is a mandal of Kamareddy district today.
No freely licensed photograph
of this building yet
of this building yet
Tripurantakeswara Veerabhadra Swamy Kshetram Sri Vasavi Arya Vysya Nityanna Satram, Ayyasagaram
Ayyasagaram,
Mahabubnagar
Two independent Arya Vysya sources name this satram. The Telugu Wikipedia satram register gives 'Tripurantakeswara Veerabhadra Swamy kshetra Sri Vasavi Arya Vysya Nityanna Satram, Ayyasagaram, near Amanagallu on the Srisailam-Hyde…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Degree College, Mahabubnagar
Mahabubnagar,
Mahabubnagar
Listed among the degree colleges of Mahabubnagar town on Telugu Wikipedia. CAVEAT: the source states only that a college of this name exists - it does NOT state Arya Vysya management, trusteeship or community affiliation. Recorded…
No freely licensed photograph
of this building yet
of this building yet
Arya Vaishya nithyanna satram at Basar (listed as 'Hyasapuri ... Kanyaka Parameshwari Charitable Trust')
Basar,
Nirmal
Arya Vysya pilgrim satram at the Basar kshetram, listed for 'Basara, Adilabad District' (pre-2016 district; Basar is in Nirmal district today). Institution name is garbled by the source site's machine translation.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Rajarajeshwari Kshetra Arya Vysya Vasavi Nitya Anna Satra Sangam, Vasavinagar
Vemulawada,
Rajanna Sircilla
Arya Vysya nitya-anna satram at the Raja Rajeshwara Swamy kshetram; the community directories give its locality as Vasavinagar and (in the Arya Vysya Sangam directory) Agraharam, Vemulawada mandal. Listed as 'Sri Kaleshwara Muktes…
No freely licensed photograph
of this building yet
of this building yet
S.R.R.K. Arya Vysya Vasavi Nityanna Satra Sangam, Vemulawada
Vemulawada,
Rajanna Sircilla
Same institution under an abbreviated name in a second community temple directory.
No freely licensed photograph
of this building yet
of this building yet
Sri Yadagiri Lakshminarasimha Swamy Vasavi Nityanna Satram, Surendrapuri
Yadagirigutta,
Yadadri Bhuvanagiri
A second Arya Vysya nitya-anna satram recorded in the Telugu register at Surendrapuri, near Yadagirigutta. It appears only in the Telugu register, not in the two English lists, so it is marked low.